BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645605|ref|NP_207781.1| hypothetical protein
[Helicobacter pylori 26695]
         (222 letters)

Database: /var/www/html/HP/blast_new/blast/db/pdbaa
           13,198 sequences; 2,899,336 total letters

Searching...........................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1KEK|A  Chain A, Crystal Structure Of The Free Radical I...    26  4.2

>pdb|1KEK|A Chain A, Crystal Structure Of The Free Radical Intermediate Of
           Pyruvate:ferredoxin Oxidoreductase
 pdb|1KEK|B Chain B, Crystal Structure Of The Free Radical Intermediate Of
           Pyruvate:ferredoxin Oxidoreductase
 pdb|1B0P|A Chain A, Crystal Structure Of Pyruvate-Ferredoxin Oxidoreductase
           From Desulfovibrio Africanus
 pdb|1B0P|B Chain B, Crystal Structure Of Pyruvate-Ferredoxin Oxidoreductase
           From Desulfovibrio Africanus
 pdb|2PDA|A Chain A, Crystal Structure Of The Complex Between Pyruvate-
           Ferredoxin Oxidoreductase From Desulfovibrio Africanus
           And Pyruvate.
 pdb|2PDA|B Chain B, Crystal Structure Of The Complex Between Pyruvate-
           Ferredoxin Oxidoreductase From Desulfovibrio Africanus
           And Pyruvate
          Length = 1231

 Score = 25.8 bits (55), Expect = 4.2
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 4/54 (7%)

Query: 71  NHNKQGIHYCTENKKTGKCDPIDNVFRTTRLDNELEQEIQTLTLDLTKAPNKDA 124
           NH   GI    E+  TG   P+DN F  T     ++ +   L  D T   NK A
Sbjct: 387 NHFTVGI----EDDVTGTSLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQA 436



  Database: /var/www/html/HP/blast_new/blast/db/pdbaa
    Posted date:  Dec 20, 2002 11:08 AM
  Number of letters in database: 2,899,336
  Number of sequences in database:  13,198
  
Lambda     K      H
   0.317    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,210,374
Number of Sequences: 13198
Number of extensions: 45770
Number of successful extensions: 76
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 75
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 2,899,336
effective HSP length: 85
effective length of query: 137
effective length of database: 1,777,506
effective search space: 243518322
effective search space used: 243518322
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)