BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15645058|ref|NP_207228.1| hypothetical protein
[Helicobacter pylori 26695]
         (55 letters)

Database: /home/scwang/download_20020708_db/nr
           1,026,957 sequences; 324,149,939 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_207228.1|  (NC_000915) hypothetical protein [Helicoba...   110  4e-24

>ref|NP_207228.1| (NC_000915) hypothetical protein [Helicobacter pylori 26695]
 pir||F64573 hypothetical protein HP0430 - Helicobacter pylori (strain 26695)
 gb|AAD07513.1| (AE000559) H. pylori predicted coding region HP0430 [Helicobacter
          pylori 26695]
          Length = 55

 Score =  110 bits (275), Expect = 4e-24
 Identities = 55/55 (100%), Positives = 55/55 (100%)

Query: 1  MLLSDGHFTEEIQVKSSVAFGADANMIKLKKISSKVFDSAEIFQVLHFMKKSGCD 55
          MLLSDGHFTEEIQVKSSVAFGADANMIKLKKISSKVFDSAEIFQVLHFMKKSGCD
Sbjct: 1  MLLSDGHFTEEIQVKSSVAFGADANMIKLKKISSKVFDSAEIFQVLHFMKKSGCD 55



  Database: /home/scwang/download_20020708_db/nr
    Posted date:  Aug 7, 2002 12:55 PM
  Number of letters in database: 324,149,939
  Number of sequences in database:  1,026,957
  
Lambda     K      H
   0.321    0.134    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,171,028
Number of Sequences: 1026957
Number of extensions: 567186
Number of successful extensions: 1288
Number of sequences better than 1.0e-02: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1287
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 324,149,939
effective HSP length: 31
effective length of query: 24
effective length of database: 292,314,272
effective search space: 7015542528
effective search space used: 7015542528
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 91 (39.7 bits)