BLASTP 2.2.1 [Apr-13-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|15644715|ref|NP_206885.1| hypothetical protein
[Helicobacter pylori 26695]
         (62 letters)

Database: /home/scwang/download_20020708_db/nr
           1,026,957 sequences; 324,149,939 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_222800.1|  (NC_000921) putative [Helicobacter pylori ...   118  1e-26

>ref|NP_222800.1| (NC_000921) putative [Helicobacter pylori J99]
 ref|NP_206885.1| (NC_000915) hypothetical protein [Helicobacter pylori 26695]
 sp|O24912|Y085_HELPY Hypothetical protein HP0085/JHP0078
 pir||E64530 hypothetical protein (HP0085, jhp0078) - Helicobacter pylori
 gb|AAD07161.1| (AE000530) H. pylori predicted coding region HP0085 [Helicobacter
          pylori 26695]
 gb|AAD05662.1| (AE001447) putative [Helicobacter pylori J99]
          Length = 62

 Score =  118 bits (296), Expect = 1e-26
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQE 60
          MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQE
Sbjct: 1  MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQE 60

Query: 61 QK 62
          QK
Sbjct: 61 QK 62



  Database: /home/scwang/download_20020708_db/nr
    Posted date:  Aug 7, 2002 12:55 PM
  Number of letters in database: 324,149,939
  Number of sequences in database:  1,026,957
  
Lambda     K      H
   0.322    0.133    0.328 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,707,936
Number of Sequences: 1026957
Number of extensions: 578728
Number of successful extensions: 2993
Number of sequences better than 1.0e-02: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2992
Number of HSP's gapped (non-prelim): 1
length of query: 62
length of database: 324,149,939
effective HSP length: 38
effective length of query: 24
effective length of database: 285,125,573
effective search space: 6843013752
effective search space used: 6843013752
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 91 (39.7 bits)